GGT6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GGT6 Polyclonal antibody, PBS Only (33436-1-PBS)

• 

  WB analysis using 33436-1-AP (same clone as 33436-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33436-1-AP (GGT6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33436-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 33436-1-AP (same clone as 33436-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GGT6 antibody (33436-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 33436-1-PBS in a different storage buffer formulation.

GGT6 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 33436-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.3.2.2, EC:3.4.19.13, Gamma-glutamyltransferase 6, GGT 6, Glutathione hydrolase 6

---

Product Information

33436-1-PBS targets GGT6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35941

  Product name: Recombinant human GGT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-493 aa of BC063111

  Sequence: TNPQLAAVLRSAALAPTSDLAGDALLSLLAGDLGVEVPSAVPRPTLEPAEQLPVPQGILFTTPSPSAGPELLALLEAALRSGAPIPDPCPPFLQTAVSPESSALAAVDSSGSVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTSAWACPLILRGSLDDTEADVLGLVASGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHVSSVPHACCPFQGF

• Full Name: gamma-glutamyltransferase 6
• Observed Molecular Weight: 44 kDa, 51 kDa
• GenBank Accession Number: BC063111
• Gene Symbol: GGT6
• Gene ID (NCBI): 124975
• RRID: AB_3742970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P531
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gamma-glutamyltransferase 6 (GGT6) is a membrane-bound extracellular enzyme encoded by the GGT6 gene on human chromosome 17p13.2. It belongs to the gamma-glutamyltransferase (GGT; EC 2.3.2.2) family, which catalyzes the cleavage of γ-glutamyl peptide bonds in glutathione and other peptides, transferring the γ-glutamyl moiety to various acceptors such as amino acids or water .