GH1 Polyclonal antibody

• 

  WB analysis of human placenta using 17867-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 17867-1-AP (Growth hormone antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GH1 Polyclonal Antibody for ELISA

Cat No. 17867-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GH, GH N, GH1, GHN, hGH N, Somatotropin

---

Published Applications

• WB: See 1 publications below

Product Information

17867-1-AP targets GH1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12350

  Product name: Recombinant human GH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC075012

  Sequence: MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

• Full Name: GH1
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC075012
• Gene Symbol: GH1
• Gene ID (NCBI): 2688
• RRID: AB_10665815
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01241
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; PMID: 31176743; Authors - Hong Yao
human		Curr Microbiol; PMID: 24306150; Authors - Lian Chaoqun C