GHRH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GHRH Polyclonal antibody (19896-1-AP)

• 

  IHC staining of human colon cancer using 19896-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19896-1-AP (GHRH antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 19896-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 19896-1-AP (GHRH antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GHRH Polyclonal Antibody for IHC, ELISA

Cat No. 19896-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

GHRF, GRF, growth hormone releasing hormone

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19896-1-AP targets GHRH in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13787

  Product name: Recombinant human GHRH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-108 aa of BC098161

  Sequence: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG

• Full Name: growth hormone releasing hormone
• Calculated Molecular Weight: 108 aa, 12 kDa
• GenBank Accession Number: BC098161
• Gene Symbol: GHRH
• Gene ID (NCBI): 2691
• RRID: AB_3741971
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01286
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GHRH, also known as GHRF, belongs to the glucagon family. GHRH is a hypothalamic peptide that stimulates synthesis and proliferation of pituitary somatotroph cells as well as secretion of growth hormone. GHRH expression is predominantly in the human hypothalamus, with some expression in the basal ganglia (PMID: 39913072). Defects in GHRH are a cause of dwarfism, while hypersecretion of GHRH is a cause of gigantism.