Tested Applications
| Positive IHC detected in | human colon cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19896-1-AP targets GHRH in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13787 Product name: Recombinant human GHRH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-108 aa of BC098161 Sequence: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG Predict reactive species |
| Full Name | growth hormone releasing hormone |
| Calculated Molecular Weight | 108 aa, 12 kDa |
| GenBank Accession Number | BC098161 |
| Gene Symbol | GHRH |
| Gene ID (NCBI) | 2691 |
| RRID | AB_3741971 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01286 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GHRH, also known as GHRF, belongs to the glucagon family. GHRH is a hypothalamic peptide that stimulates synthesis and proliferation of pituitary somatotroph cells as well as secretion of growth hormone. GHRH expression is predominantly in the human hypothalamus, with some expression in the basal ganglia (PMID: 39913072). Defects in GHRH are a cause of dwarfism, while hypersecretion of GHRH is a cause of gigantism.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GHRH antibody 19896-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



