GHSR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GHSR Polyclonal antibody, PBS Only (30602-1-PBS)

• 

  WB analysis using 30602-1-AP (same clone as 30602-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30602-1-AP (GHSR antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 30602-1-AP (same clone as 30602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30602-1-AP (GHSR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 30602-1-AP (same clone as 30602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30602-1-AP (GHSR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 30602-1-AP (same clone as 30602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30602-1-AP (GHSR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30602-1-PBS in a different storage buffer formulation.

GHSR Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30602-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GHS R, GHRP, GH releasing peptide receptor

---

Product Information

30602-1-PBS targets GHSR in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30358

  Product name: Recombinant human GHSR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of NM_198407

  Sequence: MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFR

• Full Name: growth hormone secretagogue receptor
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: NM_198407
• Gene Symbol: GHSR
• Gene ID (NCBI): 2693
• RRID: AB_3742357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92847
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Growth Hormone Secretagogue Receptor (GHSR), also known as the ghrelin receptor, is a G protein-coupled receptor (GPCR) that plays a crucial role in regulating energy homeostasis, body weight, and growth hormone (GH) release. The GHSR is highly expressed in the brain, and also in some peripheral tissues. GHSR activity is evoked by the stomach-derived peptide hormone ghrelin and abrogated by the intestine-derived liver antimicrobial peptide 2 (LEAP2). (PMID: 33157147)