Filter: AllWB

WB analysis using 27474-1-AP (same clone as 27474-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27474-1-AP (GIF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27474-1-PBS in a different storage buffer formulation.

GIF Polyclonal antibody, PBS Only

Name: GIF Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 27474-1-PBS

GIF Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27474-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Intrinsic factor, INF, IFMH, IF, Gastric intrinsic factor

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

27474-1-PBS targets GIF in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26500 Product name: Recombinant human GIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 189-263 aa of BC037958 Sequence: VGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFH Predict reactive species
Full Name	gastric intrinsic factor (vitamin B synthesis)
Calculated Molecular Weight	45 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	BC037958
Gene Symbol	GIF
Gene ID (NCBI)	2694
RRID	AB_3742233
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P27352
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™