Product Information
31073-1-PBS targets GIGYF1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34632 Product name: Recombinant human GIGYF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 402-499 aa of BC129991 Sequence: GIQLSPGVGSSAGPPGDLEDDEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSAAATALPLSHGAARKWFYKDPQGEIQGPFTTQEMAEWF Predict reactive species |
| Full Name | GRB10 interacting GYF protein 1 |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC129991 |
| Gene Symbol | GIGYF1 |
| Gene ID (NCBI) | 64599 |
| RRID | AB_3716590 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O75420 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GIGYF1 encodes a GYF family adaptor protein that binds GRB10 and links receptor signaling to downstream regulatory processes. The protein contains a GYF protein interaction domain, placing it in a binding-centered adaptor framework. It is associated with insulin-like growth factor receptor signaling and with negative regulation of translational initiation and pre-mRNA catabolic process.

