GIMAP2 Monoclonal antibody, PBS Only

• 

  WB analysis of MOLT-4 using 67720-1-Ig (same clone as 67720-1-PBS)

  MOLT-4 cells were subjected to SDS PAGE followed by western blot with 67720-1-Ig (GIMAP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67720-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67720-1-Ig (same clone as 67720-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67720-1-Ig (GIMAP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67720-1-PBS in a different storage buffer formulation.

GIMAP2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67720-1-PBS

Clone No.1F2A2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

DKFZp586D0824, GIMAP2, GTPase IMAP family member 2, GTPase, IMAP family member 2, HIMAP2, IMAP2, Immunity associated protein 2

---

Product Information

67720-1-PBS targets GIMAP2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4368

  Product name: Recombinant human GIMAP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-258 aa of BC032345

  Sequence: MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAE

• Full Name: GTPase, IMAP family member 2
• Calculated Molecular Weight: 337 aa, 38 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC032345
• Gene Symbol: GIMAP2
• Gene ID (NCBI): 26157
• RRID: AB_2918500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UG22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.