GIMAP7 Monoclonal antibody, PBS Only (Capture)

GIMAP7 Monoclonal Antibody for WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA
Cat No. 68451-1-PBS
Clone No.3E4A6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Immunity-associated nucleotide 7 protein, IAN-7, IAN7, GTPase IMAP family member 7, 3E4A6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68451-1-PBS targets GIMAP7 as part of a matched antibody pair:

MP50958-1: 68451-1-PBS capture and 68451-2-PBS detection (validated in Cytometric bead array)

MP50958-2: 68451-1-PBS capture and 68451-3-PBS detection (validated in Cytometric bead array)

MP50958-3: 68451-1-PBS capture and 68451-4-PBS detection (validated in Cytometric bead array)

MP50958-4: 68451-1-PBS capture and 68451-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10740

Product name: Recombinant human GIMAP7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC027613

Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS

Predict reactive species
Full Name GTPase, IMAP family member 7
Calculated Molecular Weight 300 aa, 35 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC027613
Gene Symbol GIMAP7
Gene ID (NCBI) 168537
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NHV1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GIMAP7, also known as hIAN7 or IAN 7, is a transmembrane protein located in the endoplasmic reticulum and Golgi apparatus. GIMAP7 can promote oxidative stress and apoptosis in ovarian granulosa cells in Polycystic ovary syndrome by inhibiting the SHH signalling pathway(PMID: 36581994). The MW of this protein is 34 kDa, and this antibody specially recognises the 34 kDa protein.

Loading...
||
New chat Able
正在加载,请稍候...