Anti-Mouse GITR/TNFRSF18 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse GITR/TNFRSF18 Rabbit Recombinant Antibody, PBS Only (98466-3-PBS)

• 

  FC experiment of mouse splenocytes using 98466-3-RR (same clone as 98466-3-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse GITR/TNFRSF18 Rabbit RecAb (98466-3-RR, Clone: 250666B12) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Mouse CD25/IL-2RA (PC61.5) (APC-65137, Clone: PC61.5). CD4+ cells were pre-gated for analysis. Cells were not fixed. This data was developed using the same antibody clone with 98466-3-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98466-3-RR (same clone as 98466-3-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse GITR/TNFRSF18 Rabbit RecAb (98466-3-RR, Clone:250666B12) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). CD4+ cells were pre-gated for analysis. Cells were not fixed. This data was developed using the same antibody clone with 98466-3-PBS in a different storage buffer formulation.

GITR/TNFRSF18 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98466-3-PBS

Clone No.250666B12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD357, GITR, Tnfrsf18, AITR, Glucocorticoid-induced TNFR-related protein

---

Product Information

98466-3-PBS targets GITR/TNFRSF18 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3695

  Product name: Recombinant Mouse GITR/TNFRSF18 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-153 aa of NM_009400.2

  Sequence: QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH

• Full Name: tumor necrosis factor receptor superfamily, member 18
• Calculated Molecular Weight: 25kDa
• GenBank Accession Number: NM_009400.2
• Gene Symbol: CD357
• Gene ID (NCBI): 21936
• RRID: AB_3746095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O35714-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glucocorticoid-induced TNFR-related protein (GITR), also known as CD357 or TNFRSF18, is a member of the tumor necrosis factor receptor (TNF-R) superfamily. GITR is expressed constitutively at high levels in T regulatory cells (Treg cells) and plays a key role in dominant immunological self-tolerance maintained by CD25+CD4+ regulatory T cells (PMID: 11812990). It is expressed at low levels on resting responder T cells. The expression of GITR on T cells can be upregulated upon activation (PMID: 15770698). GITR is activated by GITR ligand (GITRL) which is mainly expressed on APC. GITR-GITRL interactions could co-stimulate both responder T-cell functions and the suppressive functions of Treg cells (PMID: 16868552).