GIYD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GIYD2 Polyclonal antibody (21158-1-AP)

• Featured Product
• KD/KO Validated

GIYD2 Polyclonal Antibody for WB, ELISA

Cat No. 21158-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

GIY YIG domain containing 2, GIYD1, GIYD2, SLX1

• 

  WB analysis of mouse brain using 21158-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 21158-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 21158-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GIYD2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21158-1-AP targets GIYD2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13094

  Product name: Recombinant human GIYD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-275 aa of BC000803

  Sequence: MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET

• Full Name: GIY-YIG domain containing 2
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC000803
• Gene Symbol: GIYD2
• Gene ID (NCBI): 79008
• RRID: AB_2752255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ83
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GIYD2 Polyclonal antibody (Cat# 21158-1-AP) has 6 citations appearing in Nature Communications, Molecular Cell, EMBO Journal, Genes & Development, and Cancer Biology & Therapy. The research fields encompass DNA repair pathway regulation, telomere maintenance and stability, replication fork processing, genome integrity, and cancer therapeutics (Olaparib resistance in prostate cancer). Citations involve both human and mouse species, with Western blot as the primary cited application.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Molecular basis of XPF-ERCC1 targeting to SLX4-dependent DNA repair pathways.; Authors - Junjie Feng
human	WB	Mol Cell; BLM and BRCA1-BARD1 coordinate complementary mechanisms of joint DNA molecule resolution; Authors - Kaima Tsukada
human		Mol Cell; SLX4IP Antagonizes Promiscuous BLM Activity during ALT Maintenance.; Authors - Stephanie Panier
human	WB	EMBO J; ATR limits Rad18-mediated PCNA monoubiquitination to preserve replication fork and telomerase-independent telomere stability; Authors - Siyuan Chen ; KD Validated
mouse	WB	Genes Dev; Break-induced replication promotes fragile telomere formation.; Authors - Zhe Yang ; KO Validated
		Cancer Biol Ther; SLX1 silencing overcomes Olaparib resistance in metastatic castration-resistant prostate cancer by disrupting SLX4-mediated DNA repair complexes; Authors - Xin Zhao