GLDC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86378-1-RR (same clone as 86378-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86378-1-RR (GLDC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86378-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Vero using 86378-1-RR (same clone as 86378-1-PBS)

  Vero cells were subjected to SDS PAGE followed by western blot with 86378-1-RR (GLDC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86378-1-PBS in a different storage buffer formulation.

GLDC Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86378-1-PBS

Clone No.250916A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, Indirect ELISA

Synonyms

aminomethyl-transferring, EC:1.4.4.2, GCE, GCSP, Glycine dehydrogenase

---

Product Information

86378-1-PBS targets GLDC in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20410

  Product name: Recombinant human GLDC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 675-1020 aa of BC111995

  Sequence: NIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQHGGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFLPNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS

• Full Name: glycine dehydrogenase (decarboxylating)
• Calculated Molecular Weight: 1020 aa, 113 kDa
• Observed Molecular Weight: 113 kDa
• GenBank Accession Number: BC111995
• Gene Symbol: GLDC
• Gene ID (NCBI): 2731
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23378
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLDC(Glycine dehydrogenase [decarboxylating], mitochondrial) is also named as GCSP and belongs to the GcvP family. It induces dramatic changes in glycolysis and glycine/serine metabolism that leads to changes in pyrimidine metabolism to regulate cancer cell proliferation(PMID:22225612).