Product Information
25733-1-AP targets GLI1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22962 Product name: Recombinant human GLI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 800-849 aa of BC013000 Sequence: YSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFS Predict reactive species |
| Full Name | GLI family zinc finger 1 |
| Calculated Molecular Weight | 1106 aa, 118 kDa |
| GenBank Accession Number | BC013000 |
| Gene Symbol | GLI1 |
| Gene ID (NCBI) | 2735 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
Able is busy answering your previous question. Please try again later.
| Species | Application | Title |
|---|---|---|
J Orthop Translat RPL35 downregulated by mechanical overloading promotes chondrocyte senescence and osteoarthritis development via Hedgehog-Gli1 signaling | ||
Antioxidants (Basel) Intragland Expression of the Shh Gene Alleviates Irradiation-Induced Salivary Gland Injury through Microvessel Protection and the Regulation of Oxidative Stress | ||
Oncotarget Investigating the role of Hedgehog/GLI1 signaling in glioblastoma cell response to temozolomide. | ||
Oncol Rep Combined inhibition of sonic Hedgehog signaling and histone deacetylase is an effective treatment for liver cancer. | ||
Biomed Environ Sci Effect of Smo SiRNA-mediated Hedgehog Signaling Pathway Inhibition on Palatal Fusion. |
Reviews
What customers say
The single review for this product rates it 4 out of 5 stars. The user performed immunofluorescence on U87 human glioblastoma cells, fixing them in 4% paraformaldehyde and staining overnight at 4°C, then counterstaining with phalloidin and DAPI. They noted the staining pattern was a mix of weak nuclear and punctate cytosolic signal, using a 1:500 dilution. Overall, the feedback suggests the antibody works for IF but produces a somewhat weak and mixed localization pattern in this cell line.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joshua (Verified Customer) (12-20-2018) | Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with phalliodin and DAPI. Staining is mix of weak nuclear and punctate cytosolic.
 |
