Product Information
25733-1-AP targets GLI1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22962 Product name: Recombinant human GLI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 800-849 aa of BC013000 Sequence: YSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEGPPHPQPLFS Predict reactive species |
| Full Name | GLI family zinc finger 1 |
| Calculated Molecular Weight | 1106 aa, 118 kDa |
| GenBank Accession Number | BC013000 |
| Gene Symbol | GLI1 |
| Gene ID (NCBI) | 2735 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
J Orthop Translat RPL35 downregulated by mechanical overloading promotes chondrocyte senescence and osteoarthritis development via Hedgehog-Gli1 signaling | ||
Oncotarget Investigating the role of Hedgehog/GLI1 signaling in glioblastoma cell response to temozolomide. | ||
Hum Cell Retraction Note: Long noncoding RNA LINC00460 promotes the progression of cervical cancer via regulation of the miR-361-3p/Gli1 axis | ||
Oncol Rep Combined inhibition of sonic Hedgehog signaling and histone deacetylase is an effective treatment for liver cancer. | ||
Am J Transl Res Involvement of hedgehog signaling in all-trans retinoic acid-mediated suppression of colon cancer |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joshua (Verified Customer) (12-20-2018) | Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with phalliodin and DAPI. Staining is mix of weak nuclear and punctate cytosolic.
![]() |






