GLOD4 Polyclonal antibody

GLOD4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16788-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

C17orf25, CGI 150, CGI150, CGI-150, GLOD 4

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 16788-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16788-1-AP (GLOD4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 16788-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16788-1-AP (GLOD4 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 16788-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16788-1-AP (GLOD4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human placenta using 16788-1-AP
human placenta tissue were subjected to SDS PAGE followed by western blot with 16788-1-AP (GLOD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16788-1-AP (GLOD4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 16788-1-AP (GLOD4 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 16788-1-AP (GLOD4 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse ovary using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 16788-1-AP (GLOD4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 16788-1-AP (GLOD4 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 16788-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 16788-1-AP (GLOD4 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GLOD4 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, mouse kidney tissue, human placenta tissue, rat brain tissue
Positive IHC detected in	human heart tissue, mouse ovary tissue, human ovary tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16788-1-AP targets GLOD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, monkey
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10222 Product name: Recombinant human GLOD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-298 aa of BC008605 Sequence: MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG Predict reactive species
Full Name	glyoxalase domain containing 4
Calculated Molecular Weight	289 aa, 33 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC008605
Gene Symbol	GLOD4
Gene ID (NCBI)	51031
RRID	AB_2247517
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9HC38
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for GLOD4 antibody 16788-1-AP	Download protocol
WB protocol for GLOD4 antibody 16788-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GLOD4 Polyclonal antibody (Cat# 16788-1-AP) has a total of 2 citations. These appear in Proceedings of the National Academy of Sciences (PNAS) and Molecular Systems Biology. The cited research spans redox biology and protein post-translational modifications (peroxynitrite-mediated protein nitration) and reproductive proteomics (proteome profiling of adult rhesus monkey ovaries). Applications used include Western blotting and immunohistochemistry, with validated reactivity in human, mouse, rat, and monkey.

Species	Application	Title
rat,mouse,human	WB	Proc Natl Acad Sci U S A Selective peroxynitrite-mediated protein nitration catalyzed by glyoxalase domain containing protein 4. Authors - Sarah Wright KO Validated View Article
monkey	IHC	Mol Biosyst Unravelling the proteome of adult rhesus monkey ovaries. Authors - Hui He View Article