GLRA2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLRA2 Polyclonal antibody, PBS Only (13831-1-PBS)

• 

  WB analysis of PBMC cells using 13831-1-AP (same clone as 13831-1-PBS)

  WB result of GLRA2 antibody (13831-1-AP, 1:600) with PBMC cells. Proteintech αGLRA2 13831-1-AP in 10% BSA / TBS 0.05% Tween-20 O/N @ 4°C Goat anti-rabbit HRP 1:10000 in 5% milk / TBS 0.05% Tween-20 1h @ RT. This data was developed using the same antibody clone with 13831-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13831-1-AP (same clone as 13831-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13831-1-AP (GLRA2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13831-1-AP (same clone as 13831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13831-1-AP (GLRA2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13831-1-AP (same clone as 13831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13831-1-AP (GLRA2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13831-1-PBS in a different storage buffer formulation.

GLRA2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13831-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13831-1-PBS targets GLRA2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4743

  Product name: Recombinant human GLRA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-255 aa of BC032864

  Sequence: MNRQLVNILTALFAFFLETNHFRTAFCKDHDSRSGKQPSQTLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMG

• Full Name: glycine receptor, alpha 2
• Calculated Molecular Weight: 452 aa, 52 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC032864
• Gene Symbol: GLRA2
• Gene ID (NCBI): 2742
• RRID: AB_2877980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23416
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glycine is an inhibitory neurotransmitter in the central nervous system. The glycine receptor (GlyR) is a member of the nicotinic acetylcholine receptor of ligand-gated ion channels. This receptor has important roles in a variety of physiological processes, especially in mediating inhibitory neurotransmission in the spinal cord and brain stem. GlyR is a pentameric receptor comprised of alpha and beta subunits. Four alpha-subunits (GLRA1, GLRA2, GLRA3, GLRA4) and one beta-subunit (GLRB) of GlyR have been identified. (PMID: 11409700; 15383648)