GLRX Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLRX Polyclonal antibody (15804-1-AP)

• Featured Product
• KD/KO Validated

GLRX Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15804-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Glutaredoxin 1, Glrx1, Glutaredoxin-1, Thioltransferase-1, TTase-1

• 

  WB analysis using 15804-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15804-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 15804-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15804-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using GLRX antibody (15804-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GLRX in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, human milk, mouse lung tissue, Jurkat cells, human placenta tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15804-1-AP targets GLRX in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8535

  Product name: Recombinant human GLRX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC005304

  Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

• Full Name: glutaredoxin (thioltransferase)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC005304
• Gene Symbol: GLRX
• Gene ID (NCBI): 2745
• RRID: AB_11232210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35754
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GLRX Polyclonal antibody (Cat# 15804-1-AP) has 17 citations spanning journals including Acta Pharm Sin B, Biomaterials, J Pharm Anal, Free Radic Biol Med, Antioxidants, Biochem Pharmacol, Eur J Pharmacol, Sci Rep, Biomedicines, Exp Cell Res, Neuroreport, Mol Vis, and eLife. Research fields cover oxidative stress and redox signaling, diabetes and glucose metabolism, cardiovascular injury, neuroprotection, ferroptosis, cancer metastasis, bone regeneration, immune regulation, and cataract pathogenesis.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharm Sin B; Dihydrotanshinone I preconditions myocardium against ischemic injury via PKM2 glutathionylation sensitive to ROS; Authors - Xunxun Wu
human	IF	Biomaterials; Modeling calcific aortic valve disease with engineered human valve tissues identifies SAMHD1 as a therapeutic target.; Authors - Xiangfu Meng
mouse	WB,IF	J Pharm Anal; Glutaredoxin-1 alleviates acetaminophen-induced liver injury by decreasing its toxic metabolites; Authors - Ying Xu
human	WB	J Pharm Anal; Naringenin boosts Parkin-mediated mitophagy via estrogen receptor alpha to maintain mitochondrial quality control and heal diabetic foot ulcer.; Authors - Xin-Meng Zhou
rat	WB	Antioxidants (Basel); Glutathione Induces Keap1 S-Glutathionylation and Mitigates Oscillating Glucose-Induced β-Cell Dysfunction by Activating Nrf2; Authors - Xiufang Chen
human,rat	WB	Free Radic Biol Med; Hydrogen sulfide improves endothelial barrier function by modulating the ubiquitination degradation of KLF4 through TRAF7 S-sulfhydration in diabetic aorta; Authors - Qianzhu Li