GLRX Polyclonal antibody

• 

  WB analysis using 15804-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15804-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 15804-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 15804-1-AP (GLRX antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 15804-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using GLRX antibody (15804-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

GLRX Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15804-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Glutaredoxin 1, Glrx1, Glutaredoxin-1, Thioltransferase-1, TTase-1

---

Tested Applications

• Positive WB detected in: A549 cells, human milk, mouse lung tissue, Jurkat cells, human placenta tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 11 publications below
• IF: See 3 publications below

Product Information

15804-1-AP targets GLRX in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8535

  Product name: Recombinant human GLRX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC005304

  Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

• Full Name: glutaredoxin (thioltransferase)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC005304
• Gene Symbol: GLRX
• Gene ID (NCBI): 2745
• RRID: AB_11232210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35754
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Elife; Hepatic AMPK signaling dynamic activation in response to REDOX balance are sentinel biomarkers of exercise and antioxidant intervention to improve blood glucose control; Authors - Meiling Wu
human	WB	Biochem Pharmacol; Ferroptosis induced by DCPS depletion diminishes hepatic metastasis in uveal melanoma; Authors - Bei Jin
human	WB	Free Radic Biol Med; Glutaredoxins concomitant with optimal ROS activate AMPK through S-glutathionylation to improve glucose metabolism in type 2 diabetes.; Authors - Kelei Dong ; KD Validated
human	WB	Sci Rep; Redox homeostasis protects mitochondria through accelerating ROS conversion to enhance hypoxia resistance in cancer cells.; Authors - Pengying Li
mouse	WB	J Bioenerg Biomembr; Glutaredoxin 1 protects neurons from oxygen-glucose deprivation/reoxygenation (OGD/R)-induced apoptosis and oxidative stress via the modulation of GSK-3β/Nrf2 signaling; Authors - Zhengguo Qiu ; KD Validated
human	WB	Mol Vis; Protective effect of Glutaredoxin 1 against oxidative stress in lens epithelial cells of age-related nuclear cataracts.; Authors - Qi Fan ; KD Validated