GLYAT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLYAT Polyclonal antibody (10900-1-AP)

GLYAT Polyclonal Antibody for WB, ELISA

Cat No. 10900-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

AAc, ACGNAT, CAT, GAT, GLYAT, glycine N acyltransferase, HRP 1(CLP)

• 

  WB analysis of mouse liver using 10900-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10900-1-AP (GLYAT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GLYAT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10900-1-AP targets GLYAT in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1351

  Product name: Recombinant human GLYAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC009785

  Sequence: MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM

• Full Name: glycine-N-acyltransferase
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009785
• Gene Symbol: GLYAT
• Gene ID (NCBI): 10249
• RRID: AB_2232373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IB77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GLYAT polyclonal antibody (Cat# 10900-1-AP) has 1 citation to date. It was cited in Journal of Ethnopharmacology (IF 6.8) in a 2026 study investigating how Xiaoyao powder attenuates acetaminophen-induced liver injury by modulating gut microbiota and upregulating GLYAT. The research falls within the fields of hepatology and ethnopharmacology, with the antibody applied in Western blot using mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Ethnopharmacol; Xiaoyao powder attenuates acetaminophen-induced liver injury through modulating gut microbiota and upregulating GLYAT.; Authors - Yajun Xiong