GLYATL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLYATL2 Polyclonal antibody (16305-1-AP)

• 

  WB analysis using 16305-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 16305-1-AP (GLYATL2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

GLYATL2 Polyclonal Antibody for WB, ELISA

Cat No. 16305-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Acyl-CoA:glycine N-acyltransferase-like protein 2, BXMAS2 10, EC:2.3.1.13, GATF B, Glycine N-acyltransferase-like protein 2

---

Tested Applications

• Positive WB detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16305-1-AP targets GLYATL2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9282

  Product name: Recombinant human GLYATL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-294 aa of BC016789

  Sequence: MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC

• Full Name: glycine-N-acyltransferase-like 2
• Calculated Molecular Weight: 294 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC016789
• Gene Symbol: GLYATL2
• Gene ID (NCBI): 219970
• RRID: AB_3741881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WU03
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLYATL2 is an N-acyltransferase that synthesizes N-acyl glycines, bioactive lipids involved in skin barrier function, sebaceous lipid metabolism, and inflammatory signaling. Expressed in skin, liver, and sebaceous glands, GLYATL2 couples medium/long-chain acyl-CoAs to glycine, contributing to both lipid homeostasis and potential detoxification pathways. Dysregulated GLYATL2 activity affects epidermal health, nociceptive signaling, and has emerging links to cancer biology, making it a noteworthy enzyme in lipid-mediated physiology.