GMPR 1/2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GMPR 1/2 Recombinant monoclonal antibody (86918-1-RR)

• 

  WB analysis using 86918-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86918-1-RR (GMPR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86918-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86918-1-RR (GMPR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

GMPR 1/2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86918-1-RR

Clone No.251923G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

GMPR, EC:1.7.1.7, GMP reductase 1, GMPR 1, GMPR1

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue, mouse skin tissue, rat skin tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86918-1-RR targets GMPR 1/2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8185

  Product name: Recombinant human GMPR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-345 aa of BC008281

  Sequence: MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

• Full Name: guanosine monophosphate reductase
• Calculated Molecular Weight: 345 aa, 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC008281
• Gene Symbol: GMPR
• Gene ID (NCBI): 2766
• RRID: AB_3745204
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P36959
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GMPR (Guanosine monophosphate reductase) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides. This antibody can recognize both GMPR1 and GMPR2 due to the high homology.