GMPR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GMPR2 Polyclonal antibody, PBS Only (15861-1-PBS)

• 

  WB analysis using 15861-1-AP (same clone as 15861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15861-1-AP (GMPR2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15861-1-PBS in a different storage buffer formulation.

GMPR2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15861-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

EC:1.7.1.7, GMPR 2, Guanosine 5'-monophosphate oxidoreductase 2

---

Product Information

15861-1-PBS targets GMPR2 in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8394

  Product name: Recombinant human GMPR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-366 aa of BC008021

  Sequence: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

• Full Name: guanosine monophosphate reductase 2
• Calculated Molecular Weight: 409aa,45 kDa; 366aa,40 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC008021
• Gene Symbol: GMPR2
• Gene ID (NCBI): 51292
• RRID: AB_2111078
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2T1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.