GMPS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86130-1-RR (same clone as 86130-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86130-1-RR (GMPS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86130-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86130-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86130-1-RR against Human GMPS were performed. The affinity constant is 2.41 nM.

GMPS Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86130-1-PBS

Clone No.250704D4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

GMP synthetase, EC:6.3.5.2, GMP synthase [glutamine-hydrolyzing]

---

Product Information

86130-1-PBS targets GMPS in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9350

  Product name: Recombinant human GMPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 345-693 aa of BC012178

  Sequence: VKIANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE

• Full Name: guanine monphosphate synthetase
• Calculated Molecular Weight: 693 aa, 77 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC012178
• Gene Symbol: GMPS
• Gene ID (NCBI): 8833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49915
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.