GNA11 Polyclonal antibody

• 

GNA11 Polyclonal Antibody for ELISA

Cat No. 16103-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

G alpha 11, G protein subunit alpha 11, GA11, GNA 11, GNA11

---

Product Information

16103-1-AP targets GNA11 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9002

  Product name: Recombinant human GNA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC001528

  Sequence: MDRLCCLRPPPHRDPARLLLASTDDKRNSPKIRPLQPAVPACLPATVRPALASSSAGLSAGFWGQKSGEPRGRVRGDQVRAATFLVISPMGRRGWRDTAPPASPHHFCLTRKRPFFVPGVYLRGLVPEAPHGECWGPAVPWGSRWGHPWQGRYNFFQQRSPLGGLCLWHL

• Full Name: guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
• Calculated Molecular Weight: 170 aa, 19 kDa
• GenBank Accession Number: BC001528
• Gene Symbol: GNA11
• Gene ID (NCBI): 2767
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29992
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.