GNAO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNAO1 Polyclonal antibody (12635-1-AP)

GNAO1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12635-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

G ALPHA o, GNAO, GNAO1

• 

  WB analysis using 12635-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12635-1-AP (GNAO1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12635-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12635-1-AP (GNAO1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 12635-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12635-1-AP (GNAO1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 12635-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12635-1-AP (GNAO1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 12635-1-AP

  IP result of anti-GNAO1 (IP:12635-1-AP, 3ug; Detection:12635-1-AP 1:600) with mouse brain tissue lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12635-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12635-1-AP (GNAO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12635-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12635-1-AP (GNAO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12635-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12635-1-AP (GNAO1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12635-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12635-1-AP (GNAO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNAO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, Y79 cells, human liver tissue, mouse testis tissue, rat testis tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12635-1-AP targets GNAO1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3330

  Product name: Recombinant human GNAO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-302 aa of BC030027

  Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY

• Full Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
• Calculated Molecular Weight: 302 aa, 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC030027
• Gene Symbol: GNAO1
• Gene ID (NCBI): 2775
• RRID: AB_2111635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09471
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i/o/t/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa.

Publications

What published studies show

Anti-GNAO1 (Cat# 12635-1-AP) has 13 citations published in journals including Blood, Nature Communications, Journal of Biological Chemistry, eLife, International Journal of Molecular Medicine, Journal of Translational Medicine, Gene, Bioscience Reports, Neurochemistry Research, International Journal of Biological Macromolecules, Journal of Healthcare Engineering, and bioRxiv. Research fields span oncology (gastric cancer, hepatocellular carcinoma, leukemia), neuroscience (neuroprotection, hair cell morphogenesis), G protein signaling, epigenetics, stem cell biology, and endocrinology.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Blood; Identification of functional cooperative mutations of GNAO1 in human acute lymphoblastic leukemia.; Authors - Lili Song
human	WB	Nat Commun; Inhibiting acute, axonal DLK palmitoylation is neuroprotective and avoids deleterious effects of cell-wide DLK inhibition; Authors - Xiaotian Zhang
human	IHC	J Transl Med; Gene expression and methylation profiles show the involvement of POMC in primary hyperparathyroidsm; Authors - Wen-Xuan Zhou
rat	WB	Int J Biol Macromol; Benzeneboronic acid-modified hyaluronic acid hydrogel enhances the differentiation of dorsal root ganglion stem cells in a three-dimensional environment; Authors - Kuangpin Liu
human	IHC	Int J Mol Med; Overexpression of GNAO1 correlates with poor prognosis in patients with gastric cancer and plays a role in gastric cancer cell proliferation and apoptosis.; Authors - Zhen Liu
human	IHC	Biosci Rep; The down-regulation of GNAO1 and its promoting role in hepatocellular carcinoma.; Authors - Pei Xiaoyu X