GNAO1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68027-1-Ig (same clone as 68027-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68027-1-Ig (GNAO1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 68027-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 68027-1-Ig (same clone as 68027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 68027-1-Ig (GNAO1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68027-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 68027-1-Ig (same clone as 68027-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 68027-1-Ig (GNAO1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68027-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 68027-1-Ig (same clone as 68027-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat cerebellum tissue using GNAO1 antibody (68027-1-Ig, Clone: 1B5G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68027-1-PBS in a different storage buffer formulation.

GNAO1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 68027-1-PBS

Clone No.1B5G2

Host / Isotype

Mouse / IgG1

Reactivity

Mouse, Rat, Rabbit, Pig, Chicken, Human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

DKFZp686O0962, G ALPHA o, GNAO, GNAO1

---

Product Information

68027-1-PBS targets GNAO1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples.

• Tested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32045

  Product name: Recombinant human GNAO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-302 aa of BC030027

  Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY

• Full Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
• Calculated Molecular Weight: 302 aa, 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC030027
• Gene Symbol: GNAO1
• Gene ID (NCBI): 2775
• RRID: AB_2918770
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P09471
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i/o/t/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa.