Product Information
25322-1-PBS targets GNAT3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18121 Product name: Recombinant human GNAT3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-137 aa of BC147016 Sequence: AIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQ Predict reactive species |
| Full Name | guanine nucleotide binding protein, alpha transducing 3 |
| Calculated Molecular Weight | 354 aa, 40 kDa |
| GenBank Accession Number | BC147016 |
| Gene Symbol | GNAT3 |
| Gene ID (NCBI) | 346562 |
| RRID | AB_3742143 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A8MTJ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GNAT3 (Guanine nucleotide-binding protein G(t) subunit alpha-3), also known as α-gustducin, is a protein that plays a key role in taste signaling. It is part of the G-protein family and is mainly expressed in Type II taste cells in the taste buds of the tongue. GNAT3 is involved in detecting sweet, bitter, and umami tastes by activating a signaling cascade that includes PLCβ2, TRPM5, and other downstream effectors.
