Use Able AI chat for product recommendations

RACK1 Polyclonal antibody

RACK1 Polyclonal Antibody for IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, IHC, ELISA

GNB2L1, H12.3, HLC 7, PIG21, RACK1

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RACK1 in ?

Tested Applications

Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10076-1-AP targets RACK1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0120

Product name: Recombinant human RACK1; GNB2L1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 56-203 aa of BC019093

Sequence: QRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPD

Predict reactive species
Full Name guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
Calculated Molecular Weight 36 kDa
GenBank Accession NumberBC019093
Gene Symbol RACK1
Gene ID (NCBI) 10399
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63244
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Members of the protein kinase C (PKC) family play a key regulatory role in a variety of cellular functions, including cell growth and differentiation, gene expression, hormone secretion and membrane function. RACK1 (receptor for activated protein kinase C 1), encoded by GNB2L1 gene, is a 317 amino acid guanine nucleotide-binding protein subunit beta-2-like 1 protein which is involved in the recruitment, assembly and/or regulation of a variety of signaling molecules, it contains 7 WD-repeats and is implicated in various protein interaction activities. RACK1 is a component of the 40S ribosomal subunit involved in translational repression. Recent finding suggests that RACK1 may be a new promising diagnosis biomarker and therapeutic target for non-small-cell lung cancer (NSCLC).

Publications

What published studies show

The RACK1 Polyclonal antibody (Cat# 10076-1-AP) has 2 citations. One appears in Environmental Toxicology and Pharmacology, studying cAMP-PKA/PKC-tyrosine phosphorylation signaling in human sperm motility and viability. The other appears in Veterinary Microbiology, investigating RACK1's role in regulating classical swine fever virus infection and NF-κB activation in porcine PK-15 cells. The associated research fields span reproductive toxicology and viral immunology.

SpeciesApplicationTitle
humanWB

Environ Toxicol Pharmacol

4-tert-octylphenol injures motility and viability of human sperm by affecting cAMP-PKA/PKC-tyrosine phosphorylation signals.

Authors - Shaoping Huang
pigIF

Vet Microbiol

Porcine RACK1 negatively regulates the infection of classical swine fever virus and the NF-κB activation in PK-15 cells.

Authors - Xiaochun Wang
Loading...
||
New chat

Able™

正在加载,请稍候...