GNB4 Polyclonal antibody

• 

  WB analysis using 11978-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11978-2-AP (GNB4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11978-2-AP

  IP result of anti-GNB4 (IP:11978-2-AP, 4ug; Detection:11978-2-AP 1:800) with mouse brain tissue lysate 4000ug.

• 

  IF Staining of HepG2 using 11978-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GNB4 antibody (11978-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of SH-SY5Y using 11978-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using GNB4 antibody (11978-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

GNB4 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11978-2-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, ELISA

Synonyms

HG2B, Guanine nucleotide-binding protein subunit beta-4, CMTD1F

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293T cells, MCF-7 cells, SH-SY5Y cells, human placenta tissue, mouse kidney tissue
• Positive IP detected in: mouse brain tissue
• Positive IF/ICC detected in: SH-SY5Y cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

11978-2-AP targets GNB4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2604

  Product name: Recombinant human GNB4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC000873

  Sequence: MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN

• Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 4
• Calculated Molecular Weight: 340 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC000873
• Gene Symbol: GNB4
• Gene ID (NCBI): 59345
• RRID: AB_2109620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein subunit beta 4 (GNB4), is one of the heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins. GNB4 is important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	BMC Med; Helicobacter pylori-induced aberrant demethylation and expression of GNB4 promotes gastric carcinogenesis via the Hippo-YAP1 pathway; Authors - Duanrui Liu
human	WB	Nat Commun; Cross-linking of the endolysosomal system reveals potential flotillin structures and cargo; Authors - Jasjot Singh