Product Information
17503-1-PBS targets GNG11 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11698 Product name: Recombinant human GNG11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009709 Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS Predict reactive species |
| Full Name | guanine nucleotide binding protein (G protein), gamma 11 |
| Calculated Molecular Weight | 73 aa, 9 kDa |
| Observed Molecular Weight | 9 kDa |
| GenBank Accession Number | BC009709 |
| Gene Symbol | GNG11 |
| Gene ID (NCBI) | 2791 |
| RRID | AB_2109758 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61952 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11 (GBG11) is a subunit of Guanine nucleotide-binding proteins (G proteins). G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
