GNG12 Polyclonal antibody

GNG12 Polyclonal Antibody for WB, ELISA

Cat No. 15781-1-AP

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis using 15781-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 15781-1-AP (GNG12 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNG12 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

A549 cells, DU 145 cells, HEK-293 cells, mouse brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15781-1-AP targets GNG12 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8470 Product name: Recombinant human GNG12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005940 Sequence: MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIIL Predict reactive species
Full Name	guanine nucleotide binding protein (G protein), gamma 12
Calculated Molecular Weight	72 aa, 8 kDa
Observed Molecular Weight	10 kDa
GenBank Accession Number	BC005940
Gene Symbol	GNG12
Gene ID (NCBI)	55970
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UBI6
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNG12 is a G protein γ subunit (chromosome 1p31.3) that regulates heterotrimeric G protein signaling and plays context-dependent roles in cancer, acting as a tumor suppressor in some cancers but pro-tumorigenic in others.