GNG13 Polyclonal antibody

• 

  WB analysis using 18223-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18223-1-AP (GNG13 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GNG13 Polyclonal Antibody for WB, ELISA

Cat No. 18223-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

h2 35, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13, G(gamma)13

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse retina tissue, rat brain tissue, rat retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18223-1-AP targets GNG13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13007

  Product name: Recombinant human GNG13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-67 aa of BC093760

  Sequence: MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL

• Full Name: guanine nucleotide binding protein (G protein), gamma 13
• Calculated Molecular Weight: 67 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC093760
• Gene Symbol: GNG13
• Gene ID (NCBI): 51764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2W3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNG13 (Guanine nucleotide-binding protein G (G gamma 13)) is a gene that encodes a gamma subunit of a heterotrimeric G protein. It is expressed in taste, retinal, and neuronal tissues and is crucial for taste transduction. In the main olfactory epithelium (MOE), most olfactory sensory neurons (OSNs) express G proteins consisting of Gαolf and Gβ1γ13. Conditional knockout of the Gng13 gene in mice significantly altered the MOE's gene expression profile and impaired the mutant animals' food - seeking capabilities (PMID: 30157062).