GNG2 Polyclonal antibody

• 

  WB analysis using 11693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11693-1-AP (GNG2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 11693-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11693-1-AP (GNG2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

GNG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11693-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

HG3F1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, G gamma-I

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• CoIP: See 1 publications below

Product Information

11693-1-AP targets GNG2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2307

  Product name: Recombinant human GNG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-71 aa of BC020774

  Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

• Full Name: guanine nucleotide binding protein (G protein), gamma 2
• Calculated Molecular Weight: 71 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC020774
• Gene Symbol: GNG2
• Gene ID (NCBI): 54331
• RRID: AB_2263277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59768
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gγ2 subunit (Gng2/GNG2) is one of subunits of the Gβγ-dimer composing heterotrimeric G protein with a Gα-subunit. Heterotrimeric G protein has been reported to be involved in various biological activities including cell proliferation, differentiation, invasion and angiogenesis. It is expressed in a range of foetal tissues as well as adult testis, adrenal gland, brain, white blood cells and lung.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	ACS Pharmacol Transl Sci; Critical Residues in the Gβ Subunit Mediate Selective Recruitment of the Gαq Heterotrimer to Activated G Protein-Coupled Receptors.; Authors - Yunjin Yao
human	WB	Am J Cancer Res; GNG2 inhibits invasion of human malignant melanoma cells with decreased FAK activity.; Authors - Ichiro Yajima ; KD Validated
human,mouse	WB,IHC	Am J Cancer Res; Reduced GNG2 expression levels in mouse malignant melanomas and human melanoma cell lines.; Authors - Yajima Ichiro I
human	WB	J Dermatol Sci; Functional analysis of GNG2 in human malignant melanoma cells.; Authors - Yajima Ichiro I
human	WB,CoIP	iScience; Identification of antimalarial drugs and bradykinin as ligands of the Plasmodium membrane protein PfSR10.; Authors - Dan Jiang