GNG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNG2 Polyclonal antibody (11693-1-AP)

• Featured Product
• KD/KO Validated

GNG2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11693-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

HG3F1, Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2, G gamma-I

• 

  WB analysis using 11693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11693-1-AP (GNG2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 11693-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11693-1-AP (GNG2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNG2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11693-1-AP targets GNG2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2307

  Product name: Recombinant human GNG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-71 aa of BC020774

  Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

• Full Name: guanine nucleotide binding protein (G protein), gamma 2
• Calculated Molecular Weight: 71 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC020774
• Gene Symbol: GNG2
• Gene ID (NCBI): 54331
• RRID: AB_2263277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59768
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gγ2 subunit (Gng2/GNG2) is one of subunits of the Gβγ-dimer composing heterotrimeric G protein with a Gα-subunit. Heterotrimeric G protein has been reported to be involved in various biological activities including cell proliferation, differentiation, invasion and angiogenesis. It is expressed in a range of foetal tissues as well as adult testis, adrenal gland, brain, white blood cells and lung.

Publications

What published studies show

The GNG2 Polyclonal antibody (Cat# 11693-1-AP) has 5 total citations. These appear in J Dermatol Sci, iScience, ACS Pharmacol Transl Sci, and Am J Cancer Res. The cited research spans G protein signaling mechanisms, malignant melanoma biology (including GNG2's role in cell invasion and FAK activity), and antimalarial drug identification targeting Plasmodium membrane proteins. Applications used include WB, IHC, and CoIP in human and mouse samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Dermatol Sci; Functional analysis of GNG2 in human malignant melanoma cells.; Authors - Yajima Ichiro I
human	WB,CoIP	iScience; Identification of antimalarial drugs and bradykinin as ligands of the Plasmodium membrane protein PfSR10.; Authors - Dan Jiang
human	WB	ACS Pharmacol Transl Sci; Critical Residues in the Gβ Subunit Mediate Selective Recruitment of the Gαq Heterotrimer to Activated G Protein-Coupled Receptors.; Authors - Yunjin Yao
human,mouse	WB,IHC	Am J Cancer Res; Reduced GNG2 expression levels in mouse malignant melanomas and human melanoma cell lines.; Authors - Yajima Ichiro I
human	WB	Am J Cancer Res; GNG2 inhibits invasion of human malignant melanoma cells with decreased FAK activity.; Authors - Ichiro Yajima ; KD Validated