GNG7 Polyclonal antibody

• 

  WB analysis using 31393-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31393-1-AP (GNG7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GNG7 Polyclonal Antibody for WB, ELISA

Cat No. 31393-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Mouse, Rat

Applications

WB, ELISA

Synonyms

FLJ00058, GNG7, GNGT7

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31393-1-AP targets GNG7 in WB, ELISA applications and shows reactivity with Mouse, Rat samples.

• Tested Reactivity: Mouse, Rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34754

  Product name: Recombinant human GNG7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC014466

  Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL

• Full Name: guanine nucleotide binding protein (G protein), gamma 7
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC014466
• Gene Symbol: GNG7
• Gene ID (NCBI): 2788
• RRID: AB_3669962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60262
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNG7 belongs to the large guanine nucleotide binding protein γ family and is located on chromosome 19. Related genes of the G protein family are involved in various transmembrane signaling transduction pathways. GNG7 may be associated with transmembrane signaling pathways and involved in cell contact-induced growth arrest, thus repressing uncontrolled cell proliferation in multicellular organisms. GNG7 is a heterotrimeric G protein subunit with ubiquitous expression in various tissues but low expression in cancer. GNG7 overexpression inhibited cell growth and tumorigenicity of esophageal carcinoma cells. Also, GNG7 was confirmed as an essential autophagy-inducing agent and participated in inhibiting tumor progression through mTOR pathway (PMID: 30864685, 35281820, 36159963).