GNGT2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of rat retina using 86284-1-RR (same clone as 86284-1-PBS)

  rat retina tissue were subjected to SDS PAGE followed by western blot with 86284-1-RR (GNGT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86284-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse retina using 86284-1-RR (same clone as 86284-1-PBS)

  mouse retina tissue were subjected to SDS PAGE followed by western blot with 86284-1-RR (GNGT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86284-1-PBS in a different storage buffer formulation.

GNGT2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86284-1-PBS

Clone No.250794F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

G gamma-C, G-gamma-8, G-gamma-9, GNG8, GNG9

---

Product Information

86284-1-PBS targets GNGT2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4093

  Product name: Recombinant human GNGT2 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-69 aa of BC008663

  Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

• Full Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
• Calculated Molecular Weight: 69 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC008663
• Gene Symbol: GNGT2
• Gene ID (NCBI): 2793
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.