GNMT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNMT Polyclonal antibody (18790-1-AP)

GNMT Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18790-1-AP Copied!

Publications (36)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IP, ELISA

Synonyms

EC:2.1.1.20, glycine N methyltransferase, Glycine N-methyltransferase

• 

  WB analysis of rat liver using 18790-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 18790-1-AP (GNMT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18790-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18790-1-AP (GNMT antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. Negative controls: HepG2 cells

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18790-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 18790-1-AP (GNMT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18790-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18790-1-AP (GNMT antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 18790-1-AP

  IP result of anti-GNMT (IP:18790-1-AP, 4ug; Detection:18790-1-AP 1:8000) with mouse liver tissue lysate 1840 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 18790-1-AP

  IP result of anti-GNMT (IP:18790-1-AP, 4ug; Detection:18790-1-AP 1:8000) with mouse liver tissue lysate 3040 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate hyperplasia using 18790-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 18790-1-AP (GNMT antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18790-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18790-1-AP (GNMT antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18790-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18790-1-AP (GNMT antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNMT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse liver tissue, LNCaP cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human prostate hyperplasia tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18790-1-AP targets GNMT in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4598

  Product name: Recombinant human GNMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-295 aa of BC032627

  Sequence: MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

• Full Name: glycine N-methyltransferase
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC032627
• Gene Symbol: GNMT
• Gene ID (NCBI): 27232
• RRID: AB_10597093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glycine N-methyltransferase (GNMT, EC 2.1.1.20) was found originally as an enzyme regulating the ratio of SAM to S-adenosyl- homocysteine. GNMT is conservative among different animal species. Glycine-N methyltransferase (GNMT) is a potential tumor suppressor that is commonly inactivated in human hepatoma. GNMT is abundant in liver, but very low in HepG2 cells (PMID: 12566990).

Publications

What published studies show

The GNMT antibody (catalog no. 18790-1-AP) has 36 citations. These appear in journals including Cell Death Discovery, International Journal of Biological Macromolecules, Antioxidants, Journal of Animal Science and Biotechnology, British Journal of Pharmacology, Journal of Agricultural and Food Chemistry, Molecular Metabolism, Cells, Nutrients, International Journal of Molecular Sciences, Biomolecules, Journal of Nutritional Biochemistry, Translational Oncology, Scientific Reports, Poultry Science, Molecular Nutrition & Food Research, European Journal of Nutrition, Journal of Nutrition, Endocrinology, and Journal of Animal Science. Research fields span one-carbon/methionine metabolism, DNA methylation and epigenetics, ferroptosis, hepatocellular carcinoma, and animal nutrition (pig, chicken, rat).

Automatically generated from the 36 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Discov; Activation of methionine metabolism mediated by HNF4α confers ferroptosis resistance in hepatocellular carcinoma.; Authors - Xiaolei Zhou
		Int J Biol Macromol; Atractylodes lancea (Thunb.) DC polysaccharide alleviates MASH by regulating the 1‑carbon cycle through intestinal flora remodelling.; Authors - Dajin Pi
		Antioxidants (Basel); Natural Product Auraptene Targets SLC7A11 for Degradation and Induces Hepatocellular Carcinoma Ferroptosis; Authors - Donglin Li
	WB	J Anim Sci Biotechnol; Dietary betaine activates hepaticVTGIIexpression in laying hens associated with hypomethylation ofGRgene promoter and enhancedGRexpression.; Authors - Nagmeldin A Omer
pig	WB	J Anim Sci Biotechnol; Betaine alleviates hepatic lipid metabolism disorder in finishing pigs fed a low-energy diet through regulating m(6)A RNA methylation.; Authors - Chan Liang
mouse	WB	Br J Pharmacol; Sodium valproate induces pancreatic injury by disruption of one-carbon metabolism.; Authors - Wenhao Cai