GNPAT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GNPAT Polyclonal antibody (14931-1-AP)

• Featured Product
• KD/KO Validated

GNPAT Polyclonal Antibody for WB, IP, ELISA

Cat No. 14931-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

DAP AT, DAPAT, DHAP AT, DHAPAT, GNPAT

• 

  WB analysis of HepG2 using 14931-1-AP

  WB result of GNPAT antibody (14931-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GNPAT transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 14931-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 14931-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 14931-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 14931-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14931-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 14931-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 14931-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 14931-1-AP (GNPAT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of COLO 320 using 14931-1-AP

  IP result of anti-GNPAT (IP:14931-1-AP, 4ug; Detection:14931-1-AP 1:500) with COLO 320 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GNPAT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, human placenta tissue, Transfected HEK-293 cells, COLO 320 cells, HeLa cells, PC-3 cells, mouse brain tissue
• Positive IP detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14931-1-AP targets GNPAT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6735

  Product name: Recombinant human GNPAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-680 aa of BC000450

  Sequence: PVSLRSLAAGRMSRSSYNLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKHLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL

• Full Name: glyceronephosphate O-acyltransferase
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 65-69 kDa
• GenBank Accession Number: BC000450
• Gene Symbol: GNPAT
• Gene ID (NCBI): 8443
• RRID: AB_2110546
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15228
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNPAT, also named as DAPAT and DHAPAT, belongs to the GPAT/DAPAT family. It is a key enzyme in the biosynthesis of ether phospholipids. GNPAT is localized exclusively within peroxisomes. Full GNPAT activity depends not only on the presence of AGPS, but also on the integrity of substrate channeling from GNPAT to AGPS. (PMID:21990100) This antibody recognize the 69 kDa GNPAT protein.

Publications

What published studies show

The GNPAT Polyclonal antibody (Cat# 14931-1-AP) has 18 citations spanning journals including Nature, Cell Host Microbe, Nature Cell Biology, Nature Communications, Molecular Cell, JCI, Science Advances, J Immunother Cancer, Frontiers in Immunology, and others. Research fields covered include peroxisome biology, lipid metabolism, ferroptosis, mitochondrial fission, cardiomyopathy, hepatocellular carcinoma, COPD, retinal biology, and SARS-CoV-2 infection.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Host Microbe; Infection-Induced Peroxisome Biogenesis Is a Metabolic Strategy for Herpesvirus Replication.; Authors - Pierre M Jean Beltran ; KD Validated
mouse	WB	Nat Cell Biol; Functional multi-organelle units control inflammatory lipid metabolism of macrophages; Authors - Julia A Zimmermann
human	WB	Nat Commun; Ether phospholipids are required for mitochondrial reactive oxygen species homeostasis; Authors - Ziheng Chen ; KO Validated
		Mol Cell; Uridine cytidine kinase 1 promotes phosphatidylcholine biosynthesis, facilitating SARS-CoV-2 infection.; Authors - Guangda Shi
mouse	WB	J Clin Invest; Peroxisome-derived lipids regulate adipose thermogenesis by mediating cold-induced mitochondrial fission.; Authors - Hongsuk Park
human,mouse	WB	Sci Adv; Bacterial pathogens hijack host cell peroxisomes for replication vacuole expansion and integrity; Authors - Mohammad J Hossain