GNPDA2 Polyclonal antibody

• 

  WB analysis of rat kidney using 17105-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 17105-1-AP (GNPDA2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 17105-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17105-1-AP (GNPDA2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse kidney using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse kidney using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 17105-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 17105-1-AP (GNPDA2 Antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

GNPDA2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17105-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GlcN6P deaminase 2, GNP2, GNPDA 2, GNPDA2, SB52

---

Tested Applications

• Positive WB detected in: rat kidney tissue, mouse kidney tissue
• Positive IHC detected in: human breast cancer tissue, human spleen tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

17105-1-AP targets GNPDA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10780

  Product name: Recombinant human GNPDA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC015532

  Sequence: MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

• Full Name: glucosamine-6-phosphate deaminase 2
• Calculated Molecular Weight: 275 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC015532
• Gene Symbol: GNPDA2
• Gene ID (NCBI): 132789
• RRID: AB_2878350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDQ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GNPDA2(Glucosamine-6-phosphate deaminase 2) is also named as GNP2 and belongs to the glucosamine/galactosamine-6-phosphate isomerase family. It catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Human GNPDA1 and GNPDA2 shared the same fold and were predicted to form hexameric particles(PMID:12965206). This protein has 5 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 29 kDa, 23 kDa and 27 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Glycobiology; Hexosamine biosynthesis in keratinocytes: roles of GFAT and GNPDA enzymes in the maintenance of UDP-GlcNAc content and hyaluronan synthesis.; Authors - Sanna Oikari ; KD Validated
mouse	WB	Int J Endocrinol; GNPDA2 Gene Affects Adipogenesis and Alters the Transcriptome Profile of Human Adipose-Derived Mesenchymal Stem Cells.; Authors - Lijun Wu