GNPTG Polyclonal antibody

• 

  WB analysis using 14074-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14074-1-AP (GNPTG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14074-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14074-1-AP (GNPTG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GNPTG Polyclonal Antibody for WB, ELISA

Cat No. 14074-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

N-acetylglucosamine-1-phosphotransferase subunit gamma, LP2537, GNPTAG, GlcNAc-1-phosphotransferase subunit gamma, CAB56184

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14074-1-AP targets GNPTG in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5153

  Product name: Recombinant human GNPTG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 5-304 aa of BC014592

  Sequence: LARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

• Full Name: N-acetylglucosamine-1-phosphate transferase, gamma subunit
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa, 68~70 kDa
• GenBank Accession Number: BC014592
• Gene Symbol: GNPTG
• Gene ID (NCBI): 84572
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJJ9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GlcNAc-phosphotransferase is a multisubunit enzyme with an α2β2γ2 arrangement that requires a detergent for solubilization. Recent cloning of cDNAs and genes encoding these subunits revealed that the α- and β-subunits are encoded by a single gene as a precursor, whereas the γ-subunit is encoded by a second gene. Sugar composition and/ or additional modifications which alter the charge of the GNPTAG oligosaccharide chains are variable in a cell type-depending manner.