GOLGA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GOLGA5 Polyclonal antibody, PBS Only (31164-1-PBS)

• 

  WB analysis using 31164-1-AP (same clone as 31164-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31164-1-AP (GOLGA5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31164-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 31164-1-AP (same clone as 31164-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GOLGA5 antibody (31164-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31164-1-PBS in a different storage buffer formulation.

GOLGA5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31164-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

31164-1-PBS targets GOLGA5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35031

  Product name: Recombinant human GOLGA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 251-410 aa of BC023021

  Sequence: RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL

• Full Name: golgi autoantigen, golgin subfamily a, 5
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 83-95 kDa
• GenBank Accession Number: BC023021
• Gene Symbol: GOLGA5
• Gene ID (NCBI): 9950
• RRID: AB_3669878
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TBA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GOLGA5 (Golgin subfamily A member 5) maintains Golgi structure, and stimulates the formation of Golgi stacks and ribbons. Also, it is involved in intra-Golgi retrograde transport (PMID: 12538640; 15718469).