GOLGA5 Recombinant monoclonal antibody, PBS Only (Detector)

GOLGA5 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83839-2-PBS
Clone No.240893F6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

240893F6, Cell proliferation-inducing gene 31 protein, Golgin 84, Golgin subfamily A member 5, Golgin-84

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83839-2-PBS targets GOLGA5 as part of a matched antibody pair:

MP00813-2: 83839-2-PBS capture and 83839-2-PBS detection (validated in Cytometric bead array)

MP00813-3: 83839-5-PBS capture and 83839-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35031

Product name: Recombinant human GOLGA5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-410 aa of BC023021

Sequence: RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL

Predict reactive species
Full Name golgi autoantigen, golgin subfamily a, 5
Calculated Molecular Weight 83 kDa
Observed Molecular Weight 80-95 kDa
GenBank Accession NumberBC023021
Gene Symbol GOLGA5
Gene ID (NCBI) 9950
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TBA6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GOLGA5 (Golgin subfamily A member 5) maintains Golgi structure, and stimulates the formation of Golgi stacks and ribbons. Also, it is involved in intra-Golgi retrograde transport (PMID: 12538640; 15718469).

Loading...
||
New chat Able
正在加载,请稍候...