GOLIM4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84818-5-RR (same clone as 84818-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84818-5-RR (GOLIM4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84818-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84818-5-RR (same clone as 84818-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLIM4 antibody (84818-5-RR, Clone: 242323F4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594-Phalloidin (red). This data was developed using the same antibody clone with 84818-5-PBS in a different storage buffer formulation.

• 

  FC experiment of U-2 OS using 84818-5-RR (same clone as 84818-5-PBS)

  1x10^6 U-2 OS cells were intracellularly stained with 0.25 ug GOLIM4 Recombinant antibody (84818-5-RR, Clone:242323F4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84818-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84818-5-RR (same clone as 84818-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug GOLIM4 Recombinant antibody (84818-5-RR, Clone:242323F4) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84818-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84818-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84818-5-RR against Human GOLIM4 were performed. The affinity constant is 0.926 nM.

GOLIM4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84818-5-PBS

Clone No.242323F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

242323F4, GIMPC, GOLPH4, GPP130, P 138

---

Product Information

84818-5-PBS targets GOLIM4 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34962

  Product name: Recombinant human GOLIM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-500 aa of NM_014498

  Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ

• Full Name: golgi integral membrane protein 4
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: NM_014498
• Gene Symbol: GOLIM4
• Gene ID (NCBI): 27333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00461
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697).