Glypican 2 Recombinant monoclonal antibody, PBS Only (Capture)

Glypican 2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83241-1-PBS
Clone No.230518A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

GPC2, 230518A4, FLJ38962, Secreted glypican-2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83241-1-PBS targets Glypican 2 as part of a matched antibody pair:

MP00156-2: 83241-1-PBS capture and 83241-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD<1.00 x 10-12M
KOff<1.00 x 10-6M
KOn=1.07 x 105M
Immunogen

CatNo: Ag4041

Product name: Recombinant human GPC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-332 aa of BC027972

Sequence: MSALRPLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGARGYSLNLIPPALISGEHLRVCPQEYTCCSSETEQRLIRETEATFRGLVEDSGSFLVHTLAARHRKFDEFFLEMLSVAQHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLLHPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRNVVSEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCQGFCLNVVRGCLSSRGLEPDWGNYLDGLLILADKLQGPFSFELTAESIGVKISEGLMYLQ

Predict reactive species
Full Name glypican 2
Calculated Molecular Weight 579 aa, 63 kDa
Observed Molecular Weight62,70-100 kDa
GenBank Accession NumberBC027972
Gene Symbol GPC2
Gene ID (NCBI) 221914
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N158
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPC2 (glypican 2), which is expected to be located in cell membrane and extracellular space. It is expressed in lymphoid tissue, skin and testis. The calculated molecular weight of the protein is 62 kDa. GPC2 is mainly active in growing nervous tissues and thyroid cancer tissues (PMID: 28616017). It participates in the growth and differentiation of neuronal axons. Increasing evidence has demonstrated the overexpression of GPC2 in neuroblastoma, a kind of childhood cancer. There is a discovery that GPC2 can be employed as a diagnostic, prognostic, and immunological predictor of generalized cancers. The study may broaden the train of thought toward application of GPC2 in immunotherapy (PMID: 35345673).

Loading...
||
New chat Able
正在加载,请稍候...