Glypican 3 Polyclonal antibody

Glypican 3 Polyclonal Antibody for ELISA
Cat No. 11145-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

DGSX, Glypican 3, GPC3, GTR2 2, Intestinal protein OCI 5, MXR7, OCI 5, OCI5, SDYS, SGB, SGBS, SGBS1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Published Applications

WBSee 4 publications below

Product Information

11145-1-AP targets Glypican 3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1433

Product name: Recombinant human GPC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-358 aa of BC035972

Sequence: AQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYR

Predict reactive species
Full Name glypican 3
Calculated Molecular Weight 580 aa, 66 kDa
Observed Molecular Weight 66 kDa
GenBank Accession NumberBC035972
Gene Symbol GPC3
Gene ID (NCBI) 2719
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51654
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glypicans (GPCs) are a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulphate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. In mammals, there are six GPCs (GPC1 to GPC6), all of which have a similar core-protein size of approx. 60 kDa and the clustering of glycosaminoglycan attachment site near the C-terminus. They are tethered to the cell surface by GPI linkages, which can be cleaved by endogenous phospholipases, thus releasing the protein. Glypican 3 (GPC3) is highly expressed in many tissues during development and plays an important role in the regulation of embryonic growth (PMID: 22467855). Loss-of-function mutations of GPC3 result in the Simpson-Golabi-Behmel overgrowth syndrome (SGBS), and Gpc-3 null mice display developmental overgrowth (PMID: 8589713; 18477453). In hepatocellular carcinoma (HCC), the overexpression of GPC3 has been demonstrated to be a reliable diagnostic indicator (PMID: 19212669; 22706665).

Publications

SpeciesApplicationTitle
humanWB

Biosens Bioelectron

Aptamer-bivalent-cholesterol-mediated proximity entropy-driven exosomal protein reporter for tumor diagnosis

Authors - Zhichao Fan
humanWB

Aging (Albany NY)

Kinsenoside ameliorates intervertebral disc degeneration through the activation of AKT-ERK1/2-Nrf2 signaling pathway.

Authors - Yanqiu Wang
ratWB

Cell Physiol Biochem

N-Cadherin Maintains the Healthy Biology of Nucleus Pulposus Cells under High-Magnitude Compression.

Authors - Zhenyu Wang
WB

Mol Med Rep

Silencing of the glypican-3 gene affects the biological behavior of human hepatocellular carcinoma cells.

Authors - Xin-Hui Qi
Loading...
||
New chat Able
正在加载,请稍候...