GPN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPN1 Polyclonal antibody, PBS Only (15752-1-PBS)

• 

  WB analysis using 15752-1-AP (same clone as 15752-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 15752-1-AP (GPN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15752-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 15752-1-AP (same clone as 15752-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 15752-1-AP (GPN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15752-1-PBS in a different storage buffer formulation.

GPN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15752-1-PBS targets GPN1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8252

  Product name: Recombinant human GPN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 66-374 aa of BC007451

  Sequence: ANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIITEALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK

• Full Name: GPN-loop GTPase 1
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC007451
• Gene Symbol: GPN1
• Gene ID (NCBI): 11321
• RRID: AB_2112818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCN4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.