GPN2 Polyclonal antibody

• 

  WB analysis using 33504-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33504-1-AP (GPN2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GPN2 Polyclonal Antibody for WB, ELISA

Cat No. 33504-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ATPBD1B, ATP-binding domain 1 family member B, GPN-loop GTPase 2, UNQ5828/PRO19647

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cell, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33504-1-AP targets GPN2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39635

  Product name: Recombinant human GPN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-310 aa of NM_018066.3

  Sequence: MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQL

• Full Name: GPN-loop GTPase 2
• Calculated Molecular Weight: 35kDa，310aa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_018066.3
• Gene Symbol: GPN2
• Gene ID (NCBI): 54707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H9Y4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gpn2 is a highly conserved protein essential for the assembly of RNA polymerase II (RNAPII) in eukaryotic cells. Mutations in Gpn2, specifically Phe105Tyr and Leu164Pro, confer temperature sensitivity and significantly impair RNAPII assembly (PMID: 39642114).