GPNMB Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP50045-1

  Sandwich ELISA standard curve of MP50045-1, GPNMB Monoclonal Matched Antibody Pair - PBS only. 66926-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard  Ag26747. 66926-4-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.

• 

  Sample test of MP50045-1

  Serum of eight individual healthy human donors was measured. The GPNMB concentration of detected samples was determined to be 172.2 pg/mL with a range of 61.0-245.8 pg/mL.

GPNMB Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 66926-4-PBS

Clone No.1E5B9

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Hematopoietic growth factor inducible neurokinin-1 type, NMB, Osteoactivin, Transmembrane glycoprotein NMB, UNQ1725/PRO9925

---

Product Information

66926-4-PBS targets GPNMB as part of a matched antibody pair:

MP50045-1: 66926-2-PBS capture and 66926-4-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Affinity:
  K_D=8.73 x 10^-11M
  K_Off=1.93 x 10^-6M
  K_On=2.21 x 10^4M
• Immunogen:

  CatNo: Ag26747

  Product name: Recombinant human GPNMB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 38-158 aa of BC011595

  Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD

• Full Name: glycoprotein (transmembrane) nmb
• Calculated Molecular Weight: 64 kDa
• GenBank Accession Number: BC011595
• Gene Symbol: GPNMB
• Gene ID (NCBI): 10457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.