GPR105 Polyclonal antibody

GPR105 Polyclonal Antibody for IHC, ELISA

Cat No. 20190-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

G protein coupled receptor 105, GPR105, KIAA0001, P2RY14, P2Y purinoceptor 14, P2Y14, UDP glucose receptor

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human stomach using 20190-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach using 20190-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 20190-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 20190-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GPR105 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IHC detected in

human stomach tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

Application	Dilution
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20190-1-AP targets GPR105 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14105 Product name: Recombinant human GPR105 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 249-338 aa of BC034989 Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL Predict reactive species
Full Name	purinergic receptor P2Y, G-protein coupled, 14
Calculated Molecular Weight	338 aa, 39 kDa
GenBank Accession Number	BC034989
Gene Symbol	P2RY14
Gene ID (NCBI)	9934
RRID	AB_10693612
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15391
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR105 (also known as P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). Notably, GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393).

Protocols

Product Specific Protocols
IHC protocol for GPR105 antibody 20190-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GPR105 Polyclonal antibody (Cat# 20190-1-AP) has 1 total citation. It was cited in Molecular Brain (Impact Factor: 3.8), in a study titled "Systematic analysis of expression signatures of neuronal subpopulations in the VTA" (2019). The research field is neuroscience, specifically focusing on neuronal subpopulation expression profiling in the ventral tegmental area. The antibody was used for IHC in mouse tissue.