GPR105 Polyclonal antibody

• 

  IHC staining of human stomach using 20190-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach using 20190-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human placenta using 20190-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 20190-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 20190-1-AP (GPR105 antibody) at dilution of 1:50 (under 40x lens).

GPR105 Polyclonal Antibody for IHC, ELISA

Cat No. 20190-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

G protein coupled receptor 105, GPR105, KIAA0001, P2RY14, P2Y purinoceptor 14, P2Y14, UDP glucose receptor

---

Tested Applications

• Positive IHC detected in: human stomach tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

20190-1-AP targets GPR105 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14105

  Product name: Recombinant human GPR105 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 249-338 aa of BC034989

  Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL

• Full Name: purinergic receptor P2Y, G-protein coupled, 14
• Calculated Molecular Weight: 338 aa, 39 kDa
• GenBank Accession Number: BC034989
• Gene Symbol: P2RY14
• Gene ID (NCBI): 9934
• RRID: AB_10693612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15391
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR105 (also known as P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). Notably, GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Mol Brain; Systematic analysis of expression signatures of neuronal subpopulations in the VTA.; Authors - Hyun Jin Kim