GPR112 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR112 Polyclonal antibody, PBS Only (31781-1-PBS)

• 

  IHC staining of mouse colon using 31781-1-AP (same clone as 31781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31781-1-AP (GPR112 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31781-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 31781-1-AP (same clone as 31781-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31781-1-AP (GPR112 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31781-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 31781-1-AP (same clone as 31781-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using GPR112 antibody (31781-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31781-1-PBS in a different storage buffer formulation.

GPR112 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 31781-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

RP1 299I16, PGR17, G protein coupled receptor 112

---

Product Information

31781-1-PBS targets GPR112 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36114

  Product name: Recombinant human GPR112 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2400-2550 aa of NM_153834

  Sequence: KWLLTNPTETAQTRCIKNEDGNATRFCSISINTGKSQWEKPKFKQCKLLQELPDKIVDLANITISDENAEDVAEHILNLINESPALGKEETKIIVSKISDISQCDEISMNLTHVMLQIINVVLEKQNNSASDLHEISNEILRIIERTGHKM

• Full Name: G protein-coupled receptor 112
• Calculated Molecular Weight: 333kDa
• GenBank Accession Number: NM_153834
• Gene Symbol: GPR112
• Gene ID (NCBI): 139378
• RRID: AB_3670112
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IZF6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR112 is a member of the adhesion G protein-coupled receptor (aGPCR) family. These receptors are characterized by a complex architecture and large size, mainly attributed to their N terminus, which contains a variety of domains involved in cell-cell and cell-matrix interactions. The function of GPR112 and other aGPCRs is closely related to key aspects of the development, architecture, and function of the nervous system. They are involved in neuronal migration, axon guidance, dendritogenesis, and synaptogenesis. Additionally, aGPCRs, including GPR112, have been implicated in the development of myelinating glial cells, which are crucial for proper neuronal signal propagation.