GPR116 Polyclonal antibody

• 

  WB analysis of HEK-293 using 14047-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14047-1-AP (GPR116 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of Y79 using 14047-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 14047-1-AP (GPR116 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14047-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14047-1-AP (GPR116 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 14047-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14047-1-AP (GPR116 Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 14047-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14047-1-AP (GPR116 Antibody) at dilution of 1:100 (under 40x lens).

GPR116 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14047-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ADGRF5, Adhesion G protein-coupled receptor F5, G protein coupled receptor 116, G-protein coupled receptor 116, KIAA0758

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Y79 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

14047-1-AP targets GPR116 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5214

  Product name: Recombinant human GPR116 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-349 aa of BC066121

  Sequence: LSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYV

• Full Name: G protein-coupled receptor 116
• Calculated Molecular Weight: 1346 aa, 149 kDa
• Observed Molecular Weight: 149 kDa
• GenBank Accession Number: BC066121
• Gene Symbol: GPR116
• Gene ID (NCBI): 221395
• RRID: AB_2113095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR116 (ADGRF5, adhesion G protein-coupled receptor F5) is involved in the G protein-coupled receptor signaling pathway and cell surface receptor signaling pathway. may act upstream of or within several processes, including glomerular filtration; pharyngeal arch artery morphogenesis; and surfactant homeostasis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Rep Med; Comprehensive proteogenomic characterization of rare kidney tumors; Authors - Ginny Xiaohe Li
human	WB,IHC	Oncotarget; High expression of GPR116 indicates poor survival outcome and promotes tumor progression in colorectal carcinoma.; Authors - Li Yang
human	IHC	Medicine (Baltimore); GPR116 overexpression correlates with poor prognosis in gastric cancer.; Authors - Tian Zheng
mouse	IF	Nat Genet; Single-cell multi-omic and spatial profiling of esophageal squamous cell carcinoma reveals the immunosuppressive role of GPR116+ pericytes in cancer metastasis; Authors - Xiaoya Pei