GPR126 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse kidney using 81632-1-RR (same clone as 81632-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81632-1-RR (GPR126 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81632-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 81632-1-RR (same clone as 81632-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81632-1-RR (GPR126 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81632-1-PBS in a different storage buffer formulation.

GPR126 Uni-rAb^® Recombinant Antibody for IHC, Indirect ELISA

Cat No. 81632-1-PBS

Clone No.6M2

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, Indirect ELISA

Synonyms

APG1, DREG, G protein coupled receptor 126, GPR126, PS1TP2, VIGR

---

Product Information

81632-1-PBS targets GPR126 in IHC, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12195

  Product name: Recombinant human GPR126 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-399 aa of BC075798

  Sequence: LSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSQCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQDGIIYRISVVIQNILRHPEV

• Full Name: G protein-coupled receptor 126
• Calculated Molecular Weight: 1222 aa, 137 kDa
• GenBank Accession Number: BC075798
• Gene Symbol: GPR126
• Gene ID (NCBI): 57211
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86SQ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR126 (G protein-coupled receptor 126) is a member of the adhesion GPCR family. GPR126 is all widely expressed on stromal cells (PMID: 25713288). It is essential for normal differentiation of promyelinating Schwann cells and for normal myelination of axons (PMID: 24227709). GPR126 regulates neural, cardiac and ear development by G-protein- and/or N-terminus-dependent signaling (PMID: 24082093, PMID: 24067352). GPR126 also stimulates VEGF signaling and angiogenesis by modulating VEGF receptor 2 expression through STAT5 and GATA2 in endothelial cells.