GPR137B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR137B Polyclonal antibody, PBS Only (16496-1-PBS)

• 

  WB analysis using 16496-1-AP (same clone as 16496-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16496-1-AP (GPR137B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16496-1-AP (same clone as 16496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16496-1-AP (GPR137B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16496-1-AP (same clone as 16496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16496-1-AP (GPR137B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 16496-1-AP (same clone as 16496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16496-1-AP (GPR137B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16496-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16496-1-AP (same clone as 16496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16496-1-AP (GPR137B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16496-1-PBS in a different storage buffer formulation.

GPR137B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16496-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

TM7SF1

---

Product Information

16496-1-PBS targets GPR137B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9633

  Product name: Recombinant human GPR137B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 253-399 aa of BC012100

  Sequence: YNLFILSFSQNKSVHSFDYDWYNVSDQADLKNQLGDAGYVLFGVVLFVWELLPTTLVVYFFRVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG

• Full Name: G protein-coupled receptor 137B
• Calculated Molecular Weight: 399 aa, 46 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC012100
• Gene Symbol: GPR137B
• Gene ID (NCBI): 7107
• RRID: AB_2247856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60478
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.