GPR141 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR141 Polyclonal antibody, PBS Only (28096-1-PBS)

• 

  IHC staining of human kidney using 28096-1-AP (same clone as 28096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28096-1-AP (GPR141 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28096-1-AP (same clone as 28096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28096-1-AP (GPR141 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28096-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28096-1-AP (same clone as 28096-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28096-1-AP (GPR141 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28096-1-PBS in a different storage buffer formulation.

GPR141 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28096-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28096-1-PBS targets GPR141 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23129

  Product name: Recombinant human GPR141 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 246-305 aa of BC120951

  Sequence: IYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR

• Full Name: G protein-coupled receptor 141
• Calculated Molecular Weight: 305 aa, 35 kDa
• GenBank Accession Number: BC120951
• Gene Symbol: GPR141
• Gene ID (NCBI): 353345
• RRID: AB_3086028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z602
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR141 (G-protein-coupled receptor 141) is a class A orphan receptor molecule of the rhodopsin family. Increased GPR141 expression enhances the migratory behavior of breast cancer, driving oncogenic pathways both in vitro and in vivo through activation of epithelial to mesenchymal transition (EMT), oncogenic mediators, and regulation of p-mTOR/p53 signaling (PMID: 37204251).