Product Information
28096-1-PBS targets GPR141 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23129 Product name: Recombinant human GPR141 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 246-305 aa of BC120951 Sequence: IYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR Predict reactive species |
| Full Name | G protein-coupled receptor 141 |
| Calculated Molecular Weight | 305 aa, 35 kDa |
| GenBank Accession Number | BC120951 |
| Gene Symbol | GPR141 |
| Gene ID (NCBI) | 353345 |
| RRID | AB_3086028 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z602 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GPR141 (G-protein-coupled receptor 141) is a class A orphan receptor molecule of the rhodopsin family. Increased GPR141 expression enhances the migratory behavior of breast cancer, driving oncogenic pathways both in vitro and in vivo through activation of epithelial to mesenchymal transition (EMT), oncogenic mediators, and regulation of p-mTOR/p53 signaling (PMID: 37204251).





